Placental lactogen (CSH1) (NM_001317) Human Mass Spec Standard

Specifications

Product Data
Description	CSH1 MS Standard C13 and N15-labeled recombinant protein (NP_001308)
Species	Human
Expression Host	HEK293
Expression cDNA Clone or AA Sequence	RC215860
Predicted MW	25 kDa
Protein Sequence	Sequence Link (showhide) >RC215860 protein sequence Red=Cloning site Green=Tags(s) MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSF LHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLL KDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRS VEGSCGF myc-FLAG tag
Tag	C-Myc/DDK
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration	>0.05 µg/µL as determined by microplate BCA method
Labeling Method	Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer	25 mM Tris-HCl, 100 mM glycine, pH 7.3
Reference Data
RefSeq	NP_001308
RefSeq Size	934
RefSeq ORF	651
Synonyms	CS-1; CSA; CSMT; GHB3; hCS-1; hCS-A; PL
Locus ID	1442
Cytogenetics	17q23.3
Summary	The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome. [provided by RefSeq, Jul 2008]
Protein Families	Druggable Genome
Protein Pathways	Jak-STAT signaling pathway, Neuroactive ligand-receptor interaction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.