Placental lactogen (CSH1) (NM_001317) Human Recombinant Protein
CAT#: TP315860
Recombinant protein of human chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1), transcript variant 1, 20 µg
View other "Placental lactogen" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215860 protein sequence
Red=Cloning site Green=Tags(s) MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSF LHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLL KDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRS VEGSCGF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001308 |
Locus ID | 1442 |
UniProt ID | P01243, P0DML2, P0DML3, A8K6C2 |
Refseq Size | 934 |
Cytogenetics | 17q23.3 |
Refseq ORF | 651 |
Synonyms | CS-1; CSA; CSMT; GHB3; hCS-1; hCS-A; PL |
Summary | The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Jak-STAT signaling pathway, Neuroactive ligand-receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411615 | CSH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420012 | CSH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411615 | Transient overexpression lysate of chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1), transcript variant 2 |
CNY 3,080.00 |
|
LY420012 | Transient overexpression lysate of chorionic somatomammotropin hormone 1 (placental lactogen) (CSH1), transcript variant 1 |
CNY 3,080.00 |
|
PH315860 | CSH1 MS Standard C13 and N15-labeled recombinant protein (NP_001308) |
CNY 19,520.00 |
其它Placental lactogen产品