STAT3 (NM_139276) Human Mass Spec Standard
CAT#: PH315836
STAT3 MS Standard C13 and N15-labeled recombinant protein (NP_644805)
View other "STAT3" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | STAT3 MS Standard C13 and N15-labeled recombinant protein (NP_644805) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215836 |
Predicted MW | 87.9 kDa |
Protein Sequence |
>RC215836 representing NM_139276
Red=Cloning site Green=Tags(s) MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSR FLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEK QQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTAL DQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQ IKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVR LLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNV NFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFS FWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISG KTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPG SAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_644805 |
RefSeq Size | 4978 |
RefSeq ORF | 2310 |
Synonyms | ADMIO; ADMIO1; APRF; HIES |
Locus ID | 6774 |
Cytogenetics | 17q21.2 |
Summary | The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. This gene also plays a role in regulating host response to viral and bacterial infections. Mutations in this gene are associated with infantile-onset multisystem autoimmune disease and hyper-immunoglobulin E syndrome. [provided by RefSeq, Aug 2020] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Acute myeloid leukemia, Adipocytokine signaling pathway, Chemokine signaling pathway, Jak-STAT signaling pathway, Pancreatic cancer, Pathways in cancer |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403728 | STAT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC408332 | STAT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403728 | Transient overexpression lysate of signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 3 |
CNY 4,840.00 |
|
LY408332 | Transient overexpression lysate of signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 1 |
CNY 3,080.00 |
|
PH312394 | STAT3 MS Standard C13 and N15-labeled recombinant protein (NP_998827) |
CNY 19,520.00 |
|
TP312394 | Recombinant protein of human signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP315836 | Recombinant protein of human signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720889 | Purified recombinant protein of Human signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 2 |
CNY 1,800.00 |