FECH (NM_001012515) Human Mass Spec Standard
CAT#: PH315223
FECH MS Standard C13 and N15-labeled recombinant protein (NP_001012533)
View other "FECH" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | FECH MS Standard C13 and N15-labeled recombinant protein (NP_001012533) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215223 |
Predicted MW | 48.63 kDa |
Protein Sequence |
>RC215223 representing NM_001012515
Red=Cloning site Green=Tags(s) MRSLGANMAAALRAAGVLLRDPLASSSWRVCQPWRWKSGAAAAAVTTETAQHAQGAKPQVQPQKRYESNI RKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKI WTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLN AIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGD PYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIET LYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRET KSFFTSQQL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001012533 |
RefSeq Size | 3835 |
RefSeq ORF | 1287 |
Synonyms | EPP; EPP1; FCE |
Locus ID | 2235 |
Cytogenetics | 18q21.31 |
Summary | The protein encoded by this gene is localized to the mitochondrion, where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Mutations in this gene are associated with erythropoietic protoporphyria. Two transcript variants encoding different isoforms have been found for this gene. A pseudogene of this gene is found on chromosome 3.[provided by RefSeq, May 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Porphyrin and chlorophyll metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400049 | FECH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422881 | FECH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400049 | Transient overexpression lysate of ferrochelatase (protoporphyria) (FECH), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3,080.00 |
|
LY422881 | Transient overexpression lysate of ferrochelatase (protoporphyria) (FECH), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 4,840.00 |
|
PH308058 | FECH MS Standard C13 and N15-labeled recombinant protein (NP_000131) |
CNY 19,520.00 |
|
TP308058 | Recombinant protein of human ferrochelatase (protoporphyria) (FECH), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP315223 | Purified recombinant protein of Homo sapiens ferrochelatase (protoporphyria) (FECH), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2,900.00 |