FECH (NM_000140) Human Recombinant Protein
CAT#: TP308058
Recombinant protein of human ferrochelatase (protoporphyria) (FECH), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg
View other "FECH" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208058 protein sequence
Red=Cloning site Green=Tags(s) MRSLGANMAAALRAAGVLLRDPLASSSWRVCQPWRWKSGAAAAAVTTETAQHAQGAKPQVQPQKRKPKTG ILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQG EGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYY NQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEV SATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDI EYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTS QQL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000131 |
Locus ID | 2235 |
UniProt ID | P22830 |
Refseq Size | 7277 |
Cytogenetics | 18q21.31 |
Refseq ORF | 1269 |
Synonyms | EPP; EPP1; FCE |
Summary | The protein encoded by this gene is localized to the mitochondrion, where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Mutations in this gene are associated with erythropoietic protoporphyria. Two transcript variants encoding different isoforms have been found for this gene. A pseudogene of this gene is found on chromosome 3.[provided by RefSeq, May 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Porphyrin and chlorophyll metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400049 | FECH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422881 | FECH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400049 | Transient overexpression lysate of ferrochelatase (protoporphyria) (FECH), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3,080.00 |
|
LY422881 | Transient overexpression lysate of ferrochelatase (protoporphyria) (FECH), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 4,840.00 |
|
PH308058 | FECH MS Standard C13 and N15-labeled recombinant protein (NP_000131) |
CNY 19,520.00 |
|
PH315223 | FECH MS Standard C13 and N15-labeled recombinant protein (NP_001012533) |
CNY 14,250.00 |
|
TP315223 | Purified recombinant protein of Homo sapiens ferrochelatase (protoporphyria) (FECH), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2,900.00 |