Tau (MAPT) (NM_016841) Human Mass Spec Standard
CAT#: PH313364
MAPT MS Standard C13 and N15-labeled recombinant protein (NP_058525)
View other "Tau" proteins (17)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 4,840.00
Specifications
Product Data | |
Description | MAPT MS Standard C13 and N15-labeled recombinant protein (NP_058525) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213364 |
Predicted MW | 36.6 kDa |
Protein Sequence |
>RC213364 representing NM_016841
Red=Cloning site Green=Tags(s) MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMV SKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYS SPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKH QPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNK KIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQ GL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_058525 |
RefSeq Size | 2529 |
RefSeq ORF | 1056 |
Synonyms | DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; PPP1R103; TAU; tau-40 |
Locus ID | 4137 |
Cytogenetics | 17q21.31 |
Summary | This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. MAPT gene mutations have been associated with several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Alzheimer's disease, MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401790 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC413819 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC413820 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC413823 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426599 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429527 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY401790 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 2 |
CNY 4,840.00 |
|
LY413819 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 3 |
CNY 3,080.00 |
|
LY413820 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 1 |
CNY 4,840.00 |
|
LY413823 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 4 |
CNY 3,080.00 |
|
LY426599 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 5 |
CNY 3,080.00 |
|
PH313312 | MAPT MS Standard C13 and N15-labeled recombinant protein (NP_005901) |
CNY 19,520.00 |
|
PH317773 | MAPT MS Standard C13 and N15-labeled recombinant protein (NP_058518) |
CNY 19,520.00 |
|
TP313312 | Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP313364 | Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP317773 | Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP720155 | Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 6 |
CNY 3,140.00 |