SIN1 (MAPKAP1) (NM_001006617) Human Mass Spec Standard
CAT#: PH311745
MAPKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001006618)
View other "SIN1" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MAPKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001006618) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211745 |
Predicted MW | 58.9 kDa |
Protein Sequence |
>RC211745 representing NM_001006617
Red=Cloning site Green=Tags(s) MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSV DITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQS ILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLI CWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLF VRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFC LVRENSSRADGVFEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKAS TKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRA STARADYFAQKQRKLNRRTSFSFQKEKKSGQQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001006618 |
RefSeq Size | 3395 |
RefSeq ORF | 1566 |
Synonyms | JC310; MIP1; SIN1; SIN1b; SIN1g |
Locus ID | 79109 |
Cytogenetics | 9q33.3 |
Summary | This gene encodes a protein that is highly similar to the yeast SIN1 protein, a stress-activated protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been described. Alternate polyadenylation sites as well as alternate 3' UTRs have been identified for transcripts of this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400381 | MAPKAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411350 | MAPKAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423519 | MAPKAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423693 | MAPKAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY400381 | Transient overexpression lysate of mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 6 |
CNY 3,080.00 |
|
LY411350 | Transient overexpression lysate of mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 2 |
CNY 3,080.00 |
|
LY423519 | Transient overexpression lysate of mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 5 |
CNY 3,080.00 |
|
LY423693 | Transient overexpression lysate of mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 1 |
CNY 4,840.00 |
|
TP311745 | Purified recombinant protein of Human mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293 cells, 20 µg |
CNY 2,900.00 |