United States
Germany
Japan
United Kingdom
China
SIN1 (MAPKAP1) (NM_001006617) Human Recombinant Protein
CAT＃: TP311745
Purified recombinant protein of Human mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293 cells, 20 µg
View other "SIN1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
| Cited in 2 publications. |
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC211745 representing NM_001006617
Red=Cloning site Green=Tags(s) MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSV DITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQS ILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLI CWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLF VRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFC LVRENSSRADGVFEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKAS TKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRA STARADYFAQKQRKLNRRTSFSFQKEKKSGQQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 58.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001006618 |
| Locus ID | 79109 |
| UniProt ID | Q9BPZ7 |
| Refseq Size | 3395 |
| Cytogenetics | 9q33.3 |
| Refseq ORF | 1566 |
| Synonyms | JC310; MIP1; SIN1; SIN1b; SIN1g |
| Summary | This gene encodes a protein that is highly similar to the yeast SIN1 protein, a stress-activated protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been described. Alternate polyadenylation sites as well as alternate 3' UTRs have been identified for transcripts of this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
A p53-Phosphoinositide Signalosome Regulates Nuclear Akt Activation
,null,
Nature cell biology
,PubMed ID 35798843
[MAPKAP1]
|
|
The Functional Proximal Proteome of Oncogenic Ras Includes mTORC2
,Kovalski, JR;Bhaduri, A;Zehnder, AM;Neela, PH;Che, Y;Wozniak, GG;Khavari, PA;,
Mol. Cell
,PubMed ID 30639242
[MAPKAP1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400381 | MAPKAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC411350 | MAPKAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423519 | MAPKAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423693 | MAPKAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY400381 | Transient overexpression lysate of mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 6 |
CNY 3,080.00 |
|
| LY411350 | Transient overexpression lysate of mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 2 |
CNY 3,080.00 |
|
| LY423519 | Transient overexpression lysate of mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 5 |
CNY 3,080.00 |
|
| LY423693 | Transient overexpression lysate of mitogen-activated protein kinase associated protein 1 (MAPKAP1), transcript variant 1 |
CNY 4,840.00 |
|
| PH311745 | MAPKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001006618) |
CNY 19,520.00 |
