RBM38 (NM_183425) Human Mass Spec Standard
CAT#: PH311451
RBM38 MS Standard C13 and N15-labeled recombinant protein (NP_906270)
View other "RBM38" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RBM38 MS Standard C13 and N15-labeled recombinant protein (NP_906270) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211451 |
Predicted MW | 12.7 kDa |
Protein Sequence |
>RC211451 representing NM_183425
Red=Cloning site Green=Tags(s) MLLQPAPCAPSAGFPRPLAAPGAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQ TGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQTG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_906270 |
RefSeq Size | 2346 |
RefSeq ORF | 363 |
Synonyms | dJ800J21.2; HSRNASEB; RNPC1; SEB4B; SEB4D |
Locus ID | 55544 |
Cytogenetics | 20q13.31 |
Summary | RNA-binding protein that specifically bind the 3' UTR of CDKN1A transcripts, leading to maintain the stability of CDKN1A transcripts, thereby acting as a mediator of the p53/TP53 family to regulate CDKN1A. CDKN1A is a cyclin-dependent kinase inhibitor transcriptionally regulated by the p53/TP53 family to induce cell cycle arrest. Isoform 1, but not isoform 2, has the ability to induce cell cycle arrest in G1 and maintain the stability of CDKN1A transcripts induced by p53/TP53. Also acts as a mRNA splicing factor. Specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2. Plays a role in myogenic differentiation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405205 | RBM38 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405205 | Transient overexpression lysate of RNA binding motif protein 38 (RBM38), transcript variant 2 |
CNY 3,080.00 |
|
TP311451 | Recombinant protein of human RNA binding motif protein 38 (RBM38), transcript variant 2, 20 µg |
CNY 2,900.00 |