RBM38 (NM_183425) Human Recombinant Protein
CAT#: TP311451
Recombinant protein of human RNA binding motif protein 38 (RBM38), transcript variant 2, 20 µg
View other "RBM38" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211451 representing NM_183425
Red=Cloning site Green=Tags(s) MLLQPAPCAPSAGFPRPLAAPGAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQ TGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQTG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_906270 |
Locus ID | 55544 |
UniProt ID | Q9H0Z9 |
Refseq Size | 2346 |
Cytogenetics | 20q13.31 |
Refseq ORF | 363 |
Synonyms | dJ800J21.2; HSRNASEB; RNPC1; SEB4B; SEB4D |
Summary | RNA-binding protein that specifically bind the 3' UTR of CDKN1A transcripts, leading to maintain the stability of CDKN1A transcripts, thereby acting as a mediator of the p53/TP53 family to regulate CDKN1A. CDKN1A is a cyclin-dependent kinase inhibitor transcriptionally regulated by the p53/TP53 family to induce cell cycle arrest. Isoform 1, but not isoform 2, has the ability to induce cell cycle arrest in G1 and maintain the stability of CDKN1A transcripts induced by p53/TP53. Also acts as a mRNA splicing factor. Specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2. Plays a role in myogenic differentiation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405205 | RBM38 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405205 | Transient overexpression lysate of RNA binding motif protein 38 (RBM38), transcript variant 2 |
CNY 3,080.00 |
|
PH311451 | RBM38 MS Standard C13 and N15-labeled recombinant protein (NP_906270) |
CNY 19,520.00 |