Apolipoprotein A V (APOA5) (NM_052968) Human Mass Spec Standard
CAT#: PH311023
APOA5 MS Standard C13 and N15-labeled recombinant protein (NP_443200)
View other "Apolipoprotein A V" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | APOA5 MS Standard C13 and N15-labeled recombinant protein (NP_443200) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211023 |
Predicted MW | 41.2 kDa |
Protein Sequence |
>RC211023 protein sequence
Red=Cloning site Green=Tags(s) MASMAAVLTWALALLSAFSATQARKGFWDYFSQTSGDKGRVEQIHQQKMAREPATLKDSLEQDLNNMNKF LEKLRPLSGSEAPRLPQDPVGMRRQLQEELEEVKARLQPYMAEAHELVGWNLEGLRQQLKPYTMDLMEQV ALRVQELQEQLRVVGEDTKAQLLGGVDEAWALLQGLQSRVVHHTGRFKELFHPYAESLVSGIGRHVQELH RSVAPHAPASPARLSRCVQVLSRKLTLKAKALHARIQQNLDQLREELSRAFAGTGTEEGAGPDPQMLSEE VRQRLQAFRQDTYLQIAAFTRAIDQETEEVQQQLAPPPPGHSAFAPEFQQTDSGKVLSKLQARLDDLWED ITHSLHDQGHSHLGDP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_443200 |
RefSeq Size | 1954 |
RefSeq ORF | 1098 |
Synonyms | APOAV; RAP3 |
Locus ID | 116519 |
Cytogenetics | 11q23.3 |
Summary | The protein encoded by this gene is an apolipoprotein that plays an important role in regulating the plasma triglyceride levels, a major risk factor for coronary artery disease. It is a component of high density lipoprotein and is highly similar to a rat protein that is upregulated in response to liver injury. Mutations in this gene have been associated with hypertriglyceridemia and hyperlipoproteinemia type 5. This gene is located proximal to the apolipoprotein gene cluster on chromosome 11q23. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Oct 2009] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403279 | APOA5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403279 | Transient overexpression lysate of apolipoprotein A-V (APOA5), transcript variant 1 |
CNY 3,080.00 |
|
TP311023 | Recombinant protein of human apolipoprotein A-V (APOA5), 20 µg |
CNY 2,900.00 |
其它Apolipoprotein A V产品