Resistin (RETN) (NM_020415) Human Mass Spec Standard
CAT#: PH310942
RETN MS Standard C13 and N15-labeled recombinant protein (NP_065148)
View other "Resistin" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RETN MS Standard C13 and N15-labeled recombinant protein (NP_065148) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210942 |
Predicted MW | 11.4 kDa |
Protein Sequence |
>RC210942 protein sequence
Red=Cloning site Green=Tags(s) MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVT GCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_065148 |
RefSeq Size | 478 |
RefSeq ORF | 324 |
Synonyms | ADSF; FIZZ3; RETN1; RSTN; XCP1 |
Locus ID | 56729 |
Cytogenetics | 19p13.2 |
Summary | This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. The encoded protein also has an antimicrobial role in skin, displaying antibacterial activity against both Gram positive and Gram negative bacteria. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2020] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402786 | RETN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402786 | Transient overexpression lysate of resistin (RETN) |
CNY 3,080.00 |
|
TP310942 | Recombinant protein of human resistin (RETN), 20 µg |
CNY 2,900.00 |
|
TP720988 | Purified recombinant protein of Human resistin (RETN), transcript variant 1 |
CNY 3,140.00 |
其它Resistin产品