Resistin (RETN) (NM_020415) Human Recombinant Protein
CAT#: TP310942
Recombinant protein of human resistin (RETN), 20 µg
View other "Resistin" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210942 protein sequence
Red=Cloning site Green=Tags(s) MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVT GCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Cell treatment (PMID: 26952643) |
Reference Data | |
RefSeq | NP_065148 |
Locus ID | 56729 |
UniProt ID | Q9HD89 |
Refseq Size | 478 |
Cytogenetics | 19p13.2 |
Refseq ORF | 324 |
Synonyms | ADSF; FIZZ3; RETN1; RSTN; XCP1 |
Summary | This gene belongs to the family defined by the mouse resistin-like genes. The characteristic feature of this family is the C-terminal stretch of 10 cys residues with identical spacing. The mouse homolog of this protein is secreted by adipocytes, and may be the hormone potentially linking obesity to type II diabetes. The encoded protein also has an antimicrobial role in skin, displaying antibacterial activity against both Gram positive and Gram negative bacteria. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2020] |
Protein Families | Druggable Genome, Secreted Protein |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Interaction between Esophageal Squamous Cell Carcinoma and Adipose Tissue in Vitro
,Nakayama, A;Aoki, S;Uchihashi, K;Nishijima-Matsunobu, A;Yamamoto, M;Kakihara, N;Iwakiri, R;Fujimoto, K;Toda, S;,
Am. J. Pathol.
,PubMed ID 26952643
[RETN]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402786 | RETN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402786 | Transient overexpression lysate of resistin (RETN) |
CNY 3,080.00 |
|
PH310942 | RETN MS Standard C13 and N15-labeled recombinant protein (NP_065148) |
CNY 19,520.00 |
|
TP720988 | Purified recombinant protein of Human resistin (RETN), transcript variant 1 |
CNY 3,140.00 |
其它Resistin产品