SNRPE (NM_003094) Human Mass Spec Standard
CAT#: PH310556
SNRPE MS Standard C13 and N15-labeled recombinant protein (NP_003085)
View other "SNRPE" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SNRPE MS Standard C13 and N15-labeled recombinant protein (NP_003085) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210556 |
Predicted MW | 10.6 kDa |
Protein Sequence |
>RC210556 representing NM_003094
Red=Cloning site Green=Tags(s) MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKS RKQLGRIMLKGDNITLLQSVSN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003085 |
RefSeq Size | 1593 |
RefSeq ORF | 276 |
Synonyms | HYPT11; Sm-E; SME; snRNP-E |
Locus ID | 6635 |
Cytogenetics | 1q32.1 |
Summary | The protein encoded by this gene is a core component of U small nuclear ribonucleoproteins, which are key components of the pre-mRNA processing spliceosome. The encoded protein plays a role in the 3' end processing of histone transcripts. This protein is one of the targets in the autoimmune disease systemic lupus erythematosus, and mutations in this gene have been associated with hypotrichosis. Several pseudogenes of this gene have been identified. [provided by RefSeq, Jun 2016] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418905 | SNRPE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418905 | Transient overexpression lysate of small nuclear ribonucleoprotein polypeptide E (SNRPE) |
CNY 3,080.00 |
|
TP310556 | Recombinant protein of human small nuclear ribonucleoprotein polypeptide E (SNRPE), 20 µg |
CNY 2,900.00 |