SNRPE (NM_003094) Human Recombinant Protein
CAT#: TP310556
Recombinant protein of human small nuclear ribonucleoprotein polypeptide E (SNRPE), 20 µg
View other "SNRPE" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210556 representing NM_003094
Red=Cloning site Green=Tags(s) MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKS RKQLGRIMLKGDNITLLQSVSN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003085 |
Locus ID | 6635 |
UniProt ID | P62304 |
Refseq Size | 1593 |
Cytogenetics | 1q32.1 |
Refseq ORF | 276 |
Synonyms | HYPT11; Sm-E; SME; snRNP-E |
Summary | The protein encoded by this gene is a core component of U small nuclear ribonucleoproteins, which are key components of the pre-mRNA processing spliceosome. The encoded protein plays a role in the 3' end processing of histone transcripts. This protein is one of the targets in the autoimmune disease systemic lupus erythematosus, and mutations in this gene have been associated with hypotrichosis. Several pseudogenes of this gene have been identified. [provided by RefSeq, Jun 2016] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418905 | SNRPE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418905 | Transient overexpression lysate of small nuclear ribonucleoprotein polypeptide E (SNRPE) |
CNY 3,080.00 |
|
PH310556 | SNRPE MS Standard C13 and N15-labeled recombinant protein (NP_003085) |
CNY 19,520.00 |