CACNB4 (NM_000726) Human Mass Spec Standard
CAT#: PH310440
CACNB4 MS Standard C13 and N15-labeled recombinant protein (NP_000717)
View other "CACNB4" proteins (9)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | CACNB4 MS Standard C13 and N15-labeled recombinant protein (NP_000717) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210440 |
Predicted MW | 58.2 kDa |
Protein Sequence |
>RC210440 protein sequence
Red=Cloning site Green=Tags(s) MSSSSYAKNGTADGPHSPTSQVARGTTTRRSRLKRSDGSTTSTSFILRQGSADSYTSRPSDSDVSLEEDR EAIRQEREQQAAIQLERAKSKPVAFAVKTNVSYCGALDEDVPVPSTAISFDAKDFLHIKEKYNNDWWIGR LVKEGCEIGFIPSPLRLENIRIQQEQKRGRFHGGKSSGNSSSSLGEMVSGTFRATPTSTAKQKQKVTEHI PPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKRAII ERSNTRSSLAEVQSEIERIFELARSLQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSRG KSQSKHLNVQLVAADKLAQCPPEMFDVILDENQLEDACEHLGEYLEAYWRATHTTSSTPMTPLLGRNLGS TALSPYPTAISGLQSQRMRHSNHSTENSPIERRSLMTSDENYHNERARKSRNRLSSSSQHSRDHYPLVEE DYPDSYQDTYKPHRNRGSPGGYSHDSRHRL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000717 |
RefSeq Size | 7979 |
RefSeq ORF | 1560 |
Synonyms | CAB4; CACNLB4; EA5; EIG9; EJM; EJM4; EJM6 |
Locus ID | 785 |
Cytogenetics | 2q23.3 |
Summary | This gene encodes a member of the beta subunit family of voltage-dependent calcium channel complex proteins. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. The protein encoded by this locus plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Certain mutations in this gene have been associated with idiopathic generalized epilepsy (IGE), juvenile myoclonic epilepsy (JME), and episodic ataxia, type 5. [provided by RefSeq, Aug 2016] |
Protein Families | Druggable Genome, Ion Channels: Other |
Protein Pathways | Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400240 | CACNB4 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC423646 | CACNB4 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC423647 | CACNB4 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC429012 | CACNB4 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY400240 | Transient overexpression lysate of calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 2 |
CN¥ 3,080.00 |
|
LY423646 | Transient overexpression lysate of calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 3 |
CN¥ 4,840.00 |
|
LY423647 | Transient overexpression lysate of calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 1 |
CN¥ 4,840.00 |
|
LY429012 | Transient overexpression lysate of calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 4 |
CN¥ 3,080.00 |
|
TP310440 | Recombinant protein of human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 2, 20 µg |
CN¥ 2,900.00 |