CACNB4 Rabbit Polyclonal Antibody

CAT#: TA341725

Rabbit Polyclonal Anti-CACNB4 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 2, 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Transient overexpression lysate of calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 1
    • 100 ug

CN¥ 4,840.00


Recombinant protein of human calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 2, 100 µg
    • 100 ug

CN¥ 9,998.00


Transient overexpression lysate of calcium channel, voltage-dependent, beta 4 subunit (CACNB4), transcript variant 2
    • 100 ug

CN¥ 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CACNB4 antibody: synthetic peptide directed towards the middle region of human CACNB4. Synthetic peptide located within the following region: FDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRISSLAEVQSEIERIF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 50 kDa
Gene Name calcium voltage-gated channel auxiliary subunit beta 4
Background This gene encodes a member ofThe beta subunit family of voltage-dependent calcium channel complex proteins. Calcium channels mediateThe influx of calcium ions intoThe cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each ofThese subunits exist, either expressed from similar genes orThe result of alternative splicing.The protein encoded byThis locus plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controllingThe alpha-1 subunit membrane targeting and shiftingThe voltage dependence of activation and inactivation. Certain mutations inThis gene have been associated with idiopathic generalized epilepsy (IGE) and juvenile myoclonic epilepsy (JME). Multiple transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Mar 2009]
Synonyms CAB4; CACNLB4; EA5; EIG9; EJM; EJM4; EJM6
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome, Ion Channels: Other
Protein Pathways Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...