gamma C Crystallin (CRYGC) (NM_020989) Human Mass Spec Standard
CAT#: PH310386
CRYGC MS Standard C13 and N15-labeled recombinant protein (NP_066269)
View other "gamma C Crystallin" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CRYGC MS Standard C13 and N15-labeled recombinant protein (NP_066269) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210386 |
Predicted MW | 20.9 kDa |
Protein Sequence |
>RC210386 protein sequence
Red=Cloning site Green=Tags(s) MGKITFYEDRAFQGRSYETTTDCPNLQPYFSRCNSIRVESGCWMLYERPNYQGQQYLLRRGEYPDYQQWM GLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYR GRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_066269 |
RefSeq Size | 645 |
RefSeq ORF | 522 |
Synonyms | CCL; CRYG3; CTRCT2 |
Locus ID | 1420 |
Cytogenetics | 2q33.3 |
Summary | This gene encodes a member of the beta/gamma-crystallin family of proteins. Crystallins constitute the major proteins of vertebrate eye lens and maintain the transparency and refractive index of the lens. This gene and several family members are present in a gene cluster on chromosome 2. Mutations in this gene have been shown to cause multiple types of cataract, including Coppock-like cataract and zonular pulverulent cataract, among others. [provided by RefSeq, Jan 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412154 | CRYGC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412154 | Transient overexpression lysate of crystallin, gamma C (CRYGC) |
CNY 3,080.00 |
|
TP310386 | Recombinant protein of human crystallin, gamma C (CRYGC), 20 µg |
CNY 2,900.00 |
其它gamma C Crystallin产品