gamma C Crystallin (CRYGC) (NM_020989) Human Recombinant Protein
CAT#: TP310386M
Recombinant protein of human crystallin, gamma C (CRYGC), 100 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9,998.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210386 protein sequence
Red=Cloning site Green=Tags(s) MGKITFYEDRAFQGRSYETTTDCPNLQPYFSRCNSIRVESGCWMLYERPNYQGQQYLLRRGEYPDYQQWM GLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYR GRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_066269 |
Locus ID | 1420 |
UniProt ID | P07315, A0A0X8GLL6 |
Refseq Size | 645 |
Cytogenetics | 2q33.3 |
Refseq ORF | 522 |
Synonyms | CCL; CRYG3; CTRCT2 |
Summary | This gene encodes a member of the beta/gamma-crystallin family of proteins. Crystallins constitute the major proteins of vertebrate eye lens and maintain the transparency and refractive index of the lens. This gene and several family members are present in a gene cluster on chromosome 2. Mutations in this gene have been shown to cause multiple types of cataract, including Coppock-like cataract and zonular pulverulent cataract, among others. [provided by RefSeq, Jan 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
其它gamma C Crystallin产品