Activator of basal transcription 1 (ABT1) (NM_013375) Human Mass Spec Standard
CAT#: PH309762
ABT1 MS Standard C13 and N15-labeled recombinant protein (NP_037507)
View other "Activator of basal transcription 1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ABT1 MS Standard C13 and N15-labeled recombinant protein (NP_037507) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209762 |
Predicted MW | 31.1 kDa |
Protein Sequence |
>RC209762 protein sequence
Red=Cloning site Green=Tags(s) MEAEESEKAATEQEPLEGTEQTLDAEEEQEESEEAACGSKKRVVPGIVYLGHIPPRFRPLHVRNLLSAYG EVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFRDKRIAKRVAASLHNTPMGARRRSPFRY DLWNLKYLHRFTWSHLSEHLAFERQVRRQRLRAEVAQAKRETDFYLQSVERGQRFLAADGDPARPDGSWT FAQRPTEQELRARKAARPGGRERARLATAQDKARSNKGLLARIFGAPPPSESMEGPSLVRDS SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_037507 |
RefSeq Size | 2264 |
RefSeq ORF | 816 |
Synonyms | Esf2; hABT1 |
Locus ID | 29777 |
Cytogenetics | 6p22.2 |
Summary | Basal transcription of genes by RNA polymerase II requires the interaction of TATA-binding protein (TBP) with the core region of class II promoters. Studies in mouse suggest that the protein encoded by this gene likely activates basal transcription from class II promoters by interaction with TBP and the class II promoter DNA. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415635 | ABT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415635 | Transient overexpression lysate of activator of basal transcription 1 (ABT1) |
CNY 3,080.00 |
|
TP309762 | Recombinant protein of human activator of basal transcription 1 (ABT1), 20 µg |
CNY 2,900.00 |
其它Activator of basal transcription 1产品