Activator of basal transcription 1 (ABT1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ABT1 antibody: synthetic peptide directed towards the middle region of human ABT1. Synthetic peptide located within the following region: EVAQAKRETDFYLQSVERGQRFLAADGDPARPDGSWTFAQRPTEQELRAR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	activator of basal transcription 1
Database Link	NP_037507 Entrez Gene 29777 Human UniProt ID Q9ULW3
Background	Basal transcription of genes by RNA polymerase II requires the interaction of TATA-binding protein (TBP) with the core region of class II promoters. Studies in mouse suggest that the protein encoded by ABT1 likely activates basal transcription from class II promoters by interaction with TBP and the class II promoter DNA.
Synonyms	hABT1
Note	Horse: 100%; Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 86%; Zebrafish: 77%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.