IL12B (NM_002187) Human Mass Spec Standard
CAT#: PH309679
IL12B MS Standard C13 and N15-labeled recombinant protein (NP_002178)
View other "IL12B" proteins (4)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
CN¥ 3,080.00
CN¥ 1,999.00
CN¥ 2,700.00
Specifications
Product Data | |
Description | IL12B MS Standard C13 and N15-labeled recombinant protein (NP_002178) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209679 |
Predicted MW | 37.2 kDa |
Protein Sequence |
>RC209679 protein sequence
Red=Cloning site Green=Tags(s) MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLG SGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRF TCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEV MVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGK SKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002178 |
RefSeq Size | 2347 |
RefSeq ORF | 984 |
Synonyms | CLMF; CLMF2; IL-12B; IMD28; IMD29; NKSF; NKSF2 |
Locus ID | 3593 |
Cytogenetics | 5q33.3 |
Summary | This gene encodes a subunit of interleukin 12, a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. Interleukin 12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit encoded by this gene, and a 35 kD subunit encoded by IL12A. This cytokine is expressed by activated macrophages that serve as an essential inducer of Th1 cells development. This cytokine has been found to be important for sustaining a sufficient number of memory/effector Th1 cells to mediate long-term protection to an intracellular pathogen. Overexpression of this gene was observed in the central nervous system of patients with multiple sclerosis (MS), suggesting a role of this cytokine in the pathogenesis of the disease. The promoter polymorphism of this gene has been reported to be associated with the severity of atopic and non-atopic asthma in children. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Allograft rejection, Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway, Type I diabetes mellitus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400792 | IL12B HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY400792 | Transient overexpression lysate of interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) (IL12B) |
CN¥ 3,080.00 |
|
TP309679 | Recombinant protein of human interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) (IL12B), 20 µg |
CN¥ 2,900.00 |
|
TP710014 | Recombinant protein of human interleukin 12B (natural killer cell stimulatory factor 2, p40) (IL12B), full length, with C-terminal DDK,expressed in sf9 cells |
CN¥ 4,020.00 |