Amyloid Precursor Protein (APP) (NM_201413) Human Mass Spec Standard
CAT#: PH309575
APP MS Standard C13 and N15-labeled recombinant protein (NP_958816)
View other "Amyloid Precursor Protein" proteins (11)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Cited in 1 publication. |
Specifications
Product Data | |
Description | APP MS Standard C13 and N15-labeled recombinant protein (NP_958816) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209575 |
Predicted MW | 83 kDa |
Protein Sequence |
>RC209575 representing NM_201413
Red=Cloning site Green=Tags(s) MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGIL QYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQER MDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWW GGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTT ESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAIPTTAA STPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKV ESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTL KHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLAN MISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRG LTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVIT LVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_958816 |
RefSeq Size | 3584 |
RefSeq ORF | 2253 |
Synonyms | AAA; ABETA; ABPP; AD1; alpha-sAPP; APPI; CTFgamma; CVAP; PN-II; PN2; preA4 |
Locus ID | 351 |
Cytogenetics | 21q21.3 |
Summary | This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Aug 2014] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Alzheimer's disease |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Leptin Boosts Cellular Metabolism by Activating AMPK and the Sirtuins to Reduce Tau Phosphorylation and u03b2-Amyloid in Neurons
,null,
Biochemical and biophysical research communications
,PubMed ID 21945934
[APP]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404408 | APP HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC404409 | APP HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC424694 | APP HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LC427815 | APP HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY404408 | Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 2 |
CN¥ 3,080.00 |
|
LY404409 | Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 3 |
CN¥ 4,840.00 |
|
LY424694 | Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 1 |
CN¥ 4,840.00 |
|
LY427815 | Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 5 |
CN¥ 3,080.00 |
|
PH315147 | APP MS Standard C13 and N15-labeled recombinant protein (NP_958817) |
CN¥ 19,520.00 |
|
TP309575 | Recombinant protein of human amyloid beta (A4) precursor protein (APP), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP315147 | Recombinant protein of human amyloid beta (A4) precursor protein (APP), transcript variant 3, 20 µg |
CN¥ 2,900.00 |
其它Amyloid Precursor Protein产品