Galectin 2 (LGALS2) (NM_006498) Human Mass Spec Standard
CAT#: PH309552
LGALS2 MS Standard C13 and N15-labeled recombinant protein (NP_006489)
View other "Galectin 2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | LGALS2 MS Standard C13 and N15-labeled recombinant protein (NP_006489) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209552 |
Predicted MW | 14.6 kDa |
Protein Sequence |
>RC209552 protein sequence
Red=Cloning site Green=Tags(s) MTGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESTIVCNSLDGSNWGQEQR EDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGFNMSSFKLKE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006489 |
RefSeq Size | 543 |
RefSeq ORF | 396 |
Synonyms | HL14 |
Locus ID | 3957 |
Cytogenetics | 22q13.1 |
Summary | The protein encoded by this gene is a soluble beta-galactoside binding lectin. The encoded protein is found as a homodimer and can bind to lymphotoxin-alpha. A single nucleotide polymorphism in an intron of this gene can alter the transcriptional level of the protein, with a resultant increased risk of myocardial infarction. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416599 | LGALS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416599 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 2 (LGALS2) |
CNY 3,080.00 |
|
TP309552 | Recombinant protein of human lectin, galactoside-binding, soluble, 2 (LGALS2), 20 µg |
CNY 2,900.00 |
其它Galectin 2产品