PRMT6 (NM_018137) Human Mass Spec Standard
CAT#: PH309527
PRMT6 MS Standard C13 and N15-labeled recombinant protein (NP_060607)
View other "PRMT6" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PRMT6 MS Standard C13 and N15-labeled recombinant protein (NP_060607) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209527 |
Predicted MW | 35.2 kDa |
Protein Sequence |
>RC209527 protein sequence
Red=Cloning site Green=Tags(s) MIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQAREVVRFNGL EDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIAPISDQ MLEWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELSRAGLEQELEA GVGGRFRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSG EITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAMED myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060607 |
RefSeq Size | 2665 |
RefSeq ORF | 948 |
Synonyms | HRMT1L6 |
Locus ID | 55170 |
Cytogenetics | 1p13.3 |
Summary | The protein encoded by this gene belongs to the arginine N-methyltransferase family, which catalyze the sequential transfer of methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins, to form methylated arginine derivatives and S-adenosyl-L-homocysteine. This protein can catalyze both, the formation of omega-N monomethylarginine and asymmetrical dimethylarginine, with a strong preference for the latter. It specifically mediates the asymmetric dimethylation of Arg2 of histone H3, and the methylated form represents a specific tag for epigenetic transcriptional repression. This protein also forms a complex with, and methylates DNA polymerase beta, resulting in stimulation of polymerase activity by enhancing DNA binding and processivity. [provided by RefSeq, Sep 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413290 | PRMT6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432201 | PRMT6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413290 | Transient overexpression lysate of protein arginine methyltransferase 6 (PRMT6) |
CNY 3,080.00 |
|
LY432201 | Transient overexpression lysate of protein arginine methyltransferase 6 (PRMT6) |
CNY 3,080.00 |
|
TP309527 | Recombinant protein of human protein arginine methyltransferase 6 (PRMT6), 20 µg |
CNY 2,900.00 |
|
TP329177 | Recombinant protein of human protein arginine methyltransferase 6 (PRMT6), 20 µg |
CNY 2,900.00 |