p63 (TP63) (NM_003722) Human Mass Spec Standard
CAT#: PH308013
TP63 MS Standard C13 and N15-labeled recombinant protein (NP_003713)
View other "p63" proteins (12)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Cited in 1 publication. |
CN¥ 3,080.00
CN¥ 1,999.00
CN¥ 2,700.00
Specifications
Product Data | |
Description | TP63 MS Standard C13 and N15-labeled recombinant protein (NP_003713) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208013 |
Predicted MW | 76.8 kDa |
Protein Sequence |
>RC208013 protein sequence
Red=Cloning site Green=Tags(s) MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWDFLEQPICSVQ PIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQ NSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYCQIAKTCP IQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPI TGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGR DRKADEDSIRKQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES LELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSPSSYGNSSPPLNKMNSMNKLPSVSQLINPQQRNAL TPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSS CLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEFSSPSHLLRTPSSASTVSVGS SETRGERVIDAVRFTLRQTISFPPRDEWNDFNFDMDARRNKQQRIKEEGE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003713 |
RefSeq Size | 4927 |
RefSeq ORF | 2040 |
Synonyms | AIS; B(p51A); B(p51B); EEC3; KET; LMS; NBP; OFC8; p40; p51; p53CP; p63; p73H; p73L; RHS; SHFM4; TP53CP; TP53L; TP73L |
Locus ID | 8626 |
Cytogenetics | 3q28 |
Summary | This gene encodes a member of the p53 family of transcription factors. The functional domains of p53 family proteins include an N-terminal transactivation domain, a central DNA-binding domain and an oligomerization domain. Alternative splicing of this gene and the use of alternative promoters results in multiple transcript variants encoding different isoforms that vary in their functional properties. These isoforms function during skin development and maintenance, adult stem/progenitor cell regulation, heart development and premature aging. Some isoforms have been found to protect the germline by eliminating oocytes or testicular germ cells that have suffered DNA damage. Mutations in this gene are associated with ectodermal dysplasia, and cleft lip/palate syndrome 3 (EEC3); split-hand/foot malformation 4 (SHFM4); ankyloblepharon-ectodermal defects-cleft lip/palate; ADULT syndrome (acro-dermato-ungual-lacrimal-tooth); limb-mammary syndrome; Rap-Hodgkin syndrome (RHS); and orofacial cleft 8. [provided by RefSeq, Aug 2016] |
Protein Families | Druggable Genome, Transcription Factors |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
p63 is required beside p53 for PERP-mediated apoptosis in uveal melanoma
,null,
British Journal of Cancer
,PubMed ID 27584665
[TP63]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418475 | TP63 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC426514 | TP63 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC426515 | TP63 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC426516 | TP63 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC426518 | TP63 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY418475 | Transient overexpression lysate of tumor protein p63 (TP63), transcript variant 1 |
CN¥ 3,080.00 |
|
LY426514 | Transient overexpression lysate of tumor protein p63 (TP63), transcript variant 2 |
CN¥ 3,080.00 |
|
LY426515 | Transient overexpression lysate of tumor protein p63 (TP63), transcript variant 3 |
CN¥ 3,080.00 |
|
LY426516 | Transient overexpression lysate of tumor protein p63 (TP63), transcript variant 4 |
CN¥ 3,080.00 |
|
LY426518 | Transient overexpression lysate of tumor protein p63 (TP63), transcript variant 6 |
CN¥ 3,080.00 |
|
TP308013 | Recombinant protein of human tumor protein p63 (TP63), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP710041 | Recombinant protein of human tumor protein p63 (TP63), transcript variant 1, with C-terminal DDK tag,expressed in sf9 cells. |
CN¥ 4,020.00 |