CD299 (CLEC4M) (NM_014257) Human Mass Spec Standard
CAT#: PH307947
CLEC4M MS Standard C13 and N15-labeled recombinant protein (NP_055072)
View other "CD299" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | CLEC4M MS Standard C13 and N15-labeled recombinant protein (NP_055072) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207947 |
Predicted MW | 45.4 kDa |
Protein Sequence |
>RC207947 protein sequence
Red=Cloning site Green=Tags(s) MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGALVLQLLSFMLLAGVLVAILV QVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELT RLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTE LKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCY FMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPS FQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055072 |
RefSeq Size | 1976 |
RefSeq ORF | 1197 |
Synonyms | CD209L; CD299; DC-SIGN2; DC-SIGNR; DCSIGNR; HP10347; L-SIGN; LSIGN |
Locus ID | 10332 |
Cytogenetics | 19p13.2 |
Summary | This gene encodes a C-type lectin that functions in cell adhesion and pathogen recognition. This receptor recognizes a wide range of evolutionarily divergent pathogens with a large impact on public health, including tuberculosis mycobacteria, and viruses including Ebola, hepatitis C, HIV-1, influenza A, West Nile virus and the SARS-CoV acute respiratory syndrome coronavirus. The protein is organized into four distinct domains: a C-terminal carbohydrate recognition domain, a flexible tandem-repeat neck domain of variable length, a transmembrane region and an N-terminal cytoplasmic domain involved in internalization. This gene is closely related in terms of both sequence and function to a neighboring gene, CD209 (Gene ID: 30835), also known as DC-SIGN. The two genes differ in viral recognition and expression patterns, with this gene showing high expression in endothelial cells of the liver, lymph node and placenta. Polymorphisms in the tandem repeat neck domain are associated with resistance to SARS infection. [provided by RefSeq, May 2020] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402300 | CLEC4M HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC403743 | CLEC4M HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402300 | Transient overexpression lysate of C-type lectin domain family 4, member M (CLEC4M), transcript variant 1 |
CNY 3,080.00 |
|
LY403743 | Transient overexpression lysate of C-type lectin domain family 4, member M (CLEC4M), transcript variant 2 |
CNY 3,080.00 |
|
PH311716 | CLEC4M MS Standard C13 and N15-labeled recombinant protein (NP_999840) |
CNY 14,250.00 |
|
TP307947 | Recombinant protein of human C-type lectin domain family 4, member M (CLEC4M), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP311716 | Purified recombinant protein of Homo sapiens C-type lectin domain family 4, member M (CLEC4M), transcript variant 2, 20 µg |
CNY 2,900.00 |