DTD1 (NM_080820) Human Mass Spec Standard
CAT#: PH307233
DTD1 MS Standard C13 and N15-labeled recombinant protein (NP_543010)
View other "DTD1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | DTD1 MS Standard C13 and N15-labeled recombinant protein (NP_543010) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207233 |
Predicted MW | 23.4 kDa |
Protein Sequence |
>RC207233 protein sequence
Red=Cloning site Green=Tags(s) MKAVVQRVTRASVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDK QYEILCVSQFTLQCVLKGNKPDFNLAMPTEQAEGFYNSFLEQLRKTYRPELIKDGKFGAYMQVHIQNDGP VTIELESPAPGTATSDPKQLSKLEKQQQRKEKTRAKGPSESSKERNTPRKEDRSASSGAEGDVSSEREP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_543010 |
RefSeq Size | 1368 |
RefSeq ORF | 627 |
Synonyms | C20orf88; DTD; DUE-B; DUEB; HARS2; pqn-68 |
Locus ID | 92675 |
Cytogenetics | 20p11.23 |
Summary | The protein encoded by this gene is similar in sequence to histidyl-tRNA synthetase, which hydrolyzes D-tyrosyl-tRNA(Tyr) into D-tyrosine and free tRNA(Tyr). The encoded protein binds the DNA unwinding element and plays a role in the initiation of DNA replication. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409024 | DTD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409024 | Transient overexpression lysate of D-tyrosyl-tRNA deacylase 1 homolog (S. cerevisiae) (DTD1), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
TP307233 | Recombinant protein of human D-tyrosyl-tRNA deacylase 1 homolog (S. cerevisiae) (DTD1), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2,900.00 |