ARG2 (NM_001172) Human Mass Spec Standard
CAT#: PH306756
ARG2 MS Standard C13 and N15-labeled recombinant protein (NP_001163)
View other "ARG2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | ARG2 MS Standard C13 and N15-labeled recombinant protein (NP_001163) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206756 |
Predicted MW | 38.6 kDa |
Protein Sequence |
>RC206756 protein sequence
Red=Cloning site Green=Tags(s) MSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGD LSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVV WVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILK NYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIA EEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQA RVRI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001163 |
RefSeq Size | 1981 |
RefSeq ORF | 1062 |
Locus ID | 384 |
Cytogenetics | 14q24.1 |
Summary | Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exists (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type II isoform encoded by this gene, is located in the mitochondria and expressed in extra-hepatic tissues, especially kidney. The physiologic role of this isoform is poorly understood; it is thought to play a role in nitric oxide and polyamine metabolism. Transcript variants of the type II gene resulting from the use of alternative polyadenylation sites have been described. [provided by RefSeq, Jul 2008] |
Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420091 | ARG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420091 | Transient overexpression lysate of arginase, type II (ARG2), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
TP306756 | Recombinant protein of human arginase, type II (ARG2), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2,900.00 |