Silencer of Death Domain (BAG4) (NM_004874) Human Mass Spec Standard
CAT#: PH306235
BAG4 MS Standard C13 and N15-labeled recombinant protein (NP_004865)
View other "Silencer of Death Domain" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | BAG4 MS Standard C13 and N15-labeled recombinant protein (NP_004865) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206235 |
Predicted MW | 49.6 kDa |
Protein Sequence |
>RC206235 protein sequence
Red=Cloning site Green=Tags(s) MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPPLYPLRPEPPQPPISWRVRGGGPAETTWLGEGGGGD GYYPSGGAWPEPGRAGGSHQEQPPYPSYNSNYWNSTARSRAPYPSTYPVRPELQGQSLNSYTNGAYGPTY PPGPGANTASYSGAYYAPGYTQTSYSTEVPSTYRSSGNSPTPVSRWIYPQQDCQTEAPPLRGQVPGYPPS QNPGMTLPHYPYGDGNRSVPQSGPTVRPQEDAWASPGAYGMGGRYPWPSSAPSAPPGNLYMTESTSPWPS SGSPQSPPSPPVQQPKDSSYPYSQSDQSMNRHNFPCSVHQYESSGTVNNDDSDLLDSQVQYSAEPQLYGN ATSDHPNNQDQSSSLPEECVPSDESTPPSIKKIIHVLEKVQYLEQEVEEFVGKKTDKAYWLLEEMLTKEL LELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKGL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004865 |
RefSeq Size | 4478 |
RefSeq ORF | 1371 |
Synonyms | BAG-4; SODD |
Locus ID | 9530 |
Cytogenetics | 8p11.23 |
Summary | The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. This protein was found to be associated with the death domain of tumor necrosis factor receptor type 1 (TNF-R1) and death receptor-3 (DR3), and thereby negatively regulates downstream cell death signaling. The regulatory role of this protein in cell death was demonstrated in epithelial cells which undergo apoptosis while integrin mediated matrix contacts are lost. Alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Mar 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417692 | BAG4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417692 | Transient overexpression lysate of BCL2-associated athanogene 4 (BAG4) |
CNY 3,080.00 |
|
TP306235 | Recombinant protein of human BCL2-associated athanogene 4 (BAG4), 20 µg |
CNY 2,900.00 |
其它Silencer of Death Domain产品