United States
Germany
Japan
United Kingdom
China
TrkB (NTRK2) (NM_001007097) Human Mass Spec Standard
CAT＃: PH305129
NTRK2 MS Standard C13 and N15-labeled recombinant protein (NP_001007098)
View other "TrkB" proteins (16)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 4,840.00
Specifications
| Product Data | |
| Description | NTRK2 MS Standard C13 and N15-labeled recombinant protein (NP_001007098) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205129 |
| Predicted MW | 53.1 kDa |
| Protein Sequence |
>RC205129 protein sequence
Red=Cloning site Green=Tags(s) MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITE IFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDL SELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEE GKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVN LTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDN PTHMNNGDYTLIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFVLFHKIPLDG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001007098 |
| RefSeq Size | 7157 |
| RefSeq ORF | 1431 |
| Synonyms | DEE58; EIEE58; GP145-TrkB; OBHD; trk-B; TRKB |
| Locus ID | 4915 |
| Cytogenetics | 9q21.33 |
| Summary | This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation. Mutations in this gene have been associated with obesity and mood disorders. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014] |
| Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
| Protein Pathways | MAPK signaling pathway, Neurotrophin signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400391 | NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416818 | NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC422715 | NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC422716 | NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC422717 | NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY400391 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant b |
CNY 3,080.00 |
|
| LY416818 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant a |
CNY 4,840.00 |
|
| LY422715 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant c |
CNY 4,840.00 |
|
| LY422716 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant d |
CNY 4,840.00 |
|
| LY422717 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant e |
CNY 4,840.00 |
|
| PH321794 | NTRK2 MS Standard C13 and N15-labeled recombinant protein (NP_006171) |
CNY 19,520.00 |
|
| TP305129 | Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant b, 20 µg |
CNY 2,900.00 |
|
| TP321794 | Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant a, 20 µg |
CNY 2,900.00 |
|
| TP700135 | Purified recombinant protein of human neurotrophic tyrosine kinase, receptor, type 2(NTRK2), transcript variant c, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
| TP710139 | Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant a, residues 32-430aa, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
|
| TP720421 | Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant b |
CNY 3,140.00 |
