SNAIL (SNAI1) (NM_005985) Human Mass Spec Standard
CAT#: PH304581
SNAI1 MS Standard C13 and N15-labeled recombinant protein (NP_005976)
View other "SNAIL" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Cited in 1 publication. |
Specifications
Product Data | |
Description | SNAI1 MS Standard C13 and N15-labeled recombinant protein (NP_005976) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204581 |
Predicted MW | 28.9 kDa |
Protein Sequence |
>RC204581 representing NM_005985
Red=Cloning site Green=Tags(s) MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQ PIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLA QLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSC PHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005976 |
RefSeq Size | 1708 |
RefSeq ORF | 792 |
Synonyms | dJ710H13.1; SLUGH2; SNA; SNAH; SNAIL; SNAIL1 |
Locus ID | 6615 |
Cytogenetics | 20q13.13 |
Summary | The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Adherens junction |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
SNAI1 recruits HDAC1 to suppress SNAI2 transcription during epithelial to mesenchymal transition
,null,
Scientific Reports
,PubMed ID 31165775
[SNAI1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401811 | SNAI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY401811 | Transient overexpression lysate of snail homolog 1 (Drosophila) (SNAI1) |
CN¥ 3,080.00 |
|
TP304581 | Recombinant protein of human snail homolog 1 (Drosophila) (SNAI1), 20 µg |
CN¥ 2,900.00 |