SNAIL (SNAI1) (NM_005985) Human Tagged ORF Clone
CAT#: RC204581
SNAI1 (Myc-DDK-tagged)-Human snail homolog 1 (Drosophila) (SNAI1)
ORF Plasmid: tGFP
"NM_005985" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
Cited in 6 publications. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | dJ710H13.1; SLUGH2; SNA; SNAH; SNAIL; SNAIL1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC204581 representing NM_005985
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCGCGCTCTTTCCTCGTCAGGAAGCCCTCCGACCCCAATCGGAAGCCTAACTACAGCGAGCTGCAGG ACTCTAATCCAGAGTTTACCTTCCAGCAGCCCTACGACCAGGCCCACCTGCTGGCAGCCATCCCACCTCC GGAGATCCTCAACCCCACCGCCTCGCTGCCAATGCTCATCTGGGACTCTGTCCTGGCGCCCCAAGCCCAG CCAATTGCCTGGGCCTCCCTTCGGCTCCAGGAGAGTCCCAGGGTGGCAGAGCTGACCTCCCTGTCAGATG AGGACAGTGGGAAAGGCTCCCAGCCCCCCAGCCCACCCTCACCGGCTCCTTCGTCCTTCTCCTCTACTTC AGTCTCTTCCTTGGAGGCCGAGGCCTATGCTGCCTTCCCAGGCTTGGGCCAAGTGCCCAAGCAGCTGGCC CAGCTCTCTGAGGCCAAGGATCTCCAGGCTCGAAAGGCCTTCAACTGCAAATACTGCAACAAGGAATACC TCAGCCTGGGTGCCCTCAAGATGCACATCCGAAGCCACACGCTGCCCTGCGTCTGCGGAACCTGCGGGAA GGCCTTCTCTAGGCCCTGGCTGCTACAAGGCCATGTCCGGACCCACACTGGCGAGAAGCCCTTCTCCTGT CCCCACTGCAGCCGTGCCTTCGCTGACCGCTCCAACCTGCGGGCCCACCTCCAGACCCACTCAGATGTCA AGAAGTACCAGTGCCAGGCGTGTGCTCGGACCTTCTCCCGAATGTCCCTGCTCCACAAGCACCAAGAGTC CGGCTGCTCAGGATGTCCCCGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC204581 representing NM_005985
Red=Cloning site Green=Tags(s) MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQ PIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLA QLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSC PHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_005985 |
ORF Size | 792 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_005985.4 |
RefSeq Size | 1708 bp |
RefSeq ORF | 795 bp |
Locus ID | 6615 |
UniProt ID | O95863 |
Protein Families | Druggable Genome |
Protein Pathways | Adherens junction |
MW | 28.9 kDa |
Gene Summary | The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2. [provided by RefSeq, Jul 2008] |
Citations (6)
The use of this cDNA Clones has been cited in the following citations: |
---|
BRD4 promotes gastric cancer progression and metastasis through acetylation-dependent stabilization of Snail
,Qin, ZY;Wang, T;Su, S;Shen, LT;Zhu, GX;Liu, Q;Zhang, L;Liu, KW;Zhang, Y;Zhou, ZH;Zhang, XN;Wen, LZ;Yao, YL;Sun, WJ;Guo, Y;Liu, KJ;Liu, L;Wang, XW;Wei, YL;Wang, J;Xiao, HL;Liu, P;Bian, XW;Chen, DF;Wang, B;,
Cancer Res.
,PubMed ID 31311807
[SNAIL]
|
SNAI1 recruits HDAC1 to suppress SNAI2 transcription during epithelial to mesenchymal transition
,Sundararajan, V;Tan, M;Tan, TZ;Ye, J;Thiery, JP;Huang, RY;,
Sci Rep
,PubMed ID 31165775
[SNAIL]
|
FBXO22 possesses both pro-tumorigenic and anti-metastatic roles in breast cancer progression
,Sun, R;Xie, HY;Qian, JX;Huang, YN;Yang, F;Zhang, FL;Shao, ZM;Li, DQ;,
Cancer Res.
,PubMed ID 29945959
[SNAIL]
|
Effect of Mutant p53 Proteins on Glycolysis and Mitochondrial Metabolism
,Eriksson, M;Ambroise, G;Ouchida, AT;Lima Queiroz, A;Smith, D;Gimenez-Cassina, A;Iwanicki, MP;Muller, PA;Norberg, E;Vakifahmetoglu-Norberg, H;,
Mol. Cell. Biol.
,PubMed ID 28993478
[SNAIL]
|
MiR-137 and miR-34a directly target Snail and inhibit EMT, invasion and sphere-forming ability of ovarian cancer cells
,Dong, P;Xiong, Y;Watari, H;Hanley, SJ;Konno, Y;Ihira, K;Yamada, T;Kudo, M;Yue, J;Sakuragi, N;,
J. Exp. Clin. Cancer Res.
,PubMed ID 27596137
[SNAIL]
|
MED28 Regulates Epithelial-Mesenchymal Transition Through NF?B in Human Breast Cancer Cells
,Huang, CY;Hsieh, NT;Li, CI;Weng, YT;Liu, HS;Lee, MF;,
J. Cell. Physiol.
,PubMed ID 27662245
[SNAIL]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC204581L1 | Lenti ORF clone of Human snail homolog 1 (Drosophila) (SNAI1), Myc-DDK-tagged |
CNY 6,000.00 |
|
RC204581L2 | Lenti ORF clone of Human snail homolog 1 (Drosophila) (SNAI1), mGFP tagged |
CNY 6,000.00 |
|
RC204581L3 | Lenti ORF clone of Human snail homolog 1 (Drosophila) (SNAI1), Myc-DDK-tagged |
CNY 6,000.00 |
|
RC204581L4 | Lenti ORF clone of Human snail homolog 1 (Drosophila) (SNAI1), mGFP tagged |
CNY 6,000.00 |
|
RG204581 | SNAI1 (tGFP-tagged) - Human snail homolog 1 (Drosophila) (SNAI1) |
CNY 5,200.00 |
|
SC122733 | SNAI1 (untagged)-Human snail homolog 1 (Drosophila) (SNAI1) |
CNY 3,600.00 |