SH2D2A (NM_003975) Human Mass Spec Standard
CAT#: PH304162
SH2D2A MS Standard C13 and N15-labeled recombinant protein (NP_003966)
View other "SH2D2A" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SH2D2A MS Standard C13 and N15-labeled recombinant protein (NP_003966) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204162 |
Predicted MW | 42.9 kDa |
Protein Sequence |
>RC204162 protein sequence
Red=Cloning site Green=Tags(s) MEFPLAQICPQGSHEAPIPTFSTFQITDMTRRSCQNLGYTAASPQAPEAASSTGNAERAEEVPGEGSLFL QAETRAWFQKTQAHWLLQHGAAPAWFHGFITRREAERLLEPKPQGCYLVRFSESAVTFVLTYRSRTCCRH FLLAQLRDGRHVVLGEDSAHARLQDLLLHYTAHPLSPYGETLTEPLARQTPEPAGLSLRTEESNFGSKSQ DPNPQYSPIIKQGQAPVPMQKEGAGEKEPSQLLRPKPPIPAKPQLPPEVYTIPVPRHRPAPRPKPSNPIY NEPDEPIAFYAMGRGSPGEAPSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQ GPPLPHQPPPAWRHTLPHNLSRQVLQDRGQAWLPLGPPQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003966 |
RefSeq Size | 1661 |
RefSeq ORF | 1167 |
Synonyms | F2771; SCAP; TSAD; VRAP |
Locus ID | 9047 |
Cytogenetics | 1q23.1 |
Summary | This gene encodes an adaptor protein thought to function in T-cell signal transduction. A related protein in mouse is responsible for the activation of lymphocyte-specific protein-tyrosine kinase and functions in downstream signaling. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010] |
Protein Pathways | VEGF signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418322 | SH2D2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431326 | SH2D2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431347 | SH2D2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431896 | SH2D2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418322 | Transient overexpression lysate of SH2 domain protein 2A (SH2D2A), transcript variant 2 |
CNY 3,080.00 |
|
LY431326 | Transient overexpression lysate of SH2 domain containing 2A (SH2D2A), transcript variant 3 |
CNY 3,080.00 |
|
LY431347 | Transient overexpression lysate of SH2 domain containing 2A (SH2D2A), transcript variant 1 |
CNY 3,080.00 |
|
LY431896 | Transient overexpression lysate of SH2 domain containing 2A (SH2D2A), transcript variant 5 |
CNY 3,080.00 |
|
TP304162 | Recombinant protein of human SH2 domain protein 2A (SH2D2A), 20 µg |
CNY 2,900.00 |