GADD45A (NM_001924) Human Mass Spec Standard
CAT#: PH304005
GADD45A MS Standard C13 and N15-labeled recombinant protein (NP_001915)
View other "GADD45A" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | GADD45A MS Standard C13 and N15-labeled recombinant protein (NP_001915) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204005 |
Predicted MW | 18.3 kDa |
Protein Sequence |
>RC204005 protein sequence
Red=Cloning site Green=Tags(s) MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVA LQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPAL SQLICFCRESRYMDQWVPVINLPER myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001915 |
RefSeq Size | 1398 |
RefSeq ORF | 495 |
Synonyms | DDIT1; GADD45 |
Locus ID | 1647 |
Cytogenetics | 1p31.3 |
Summary | This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Dec 2010] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | Cell cycle, MAPK signaling pathway, p53 signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419659 | GADD45A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419659 | Transient overexpression lysate of growth arrest and DNA-damage-inducible, alpha (GADD45A) |
CNY 3,080.00 |
|
TP304005 | Recombinant protein of human growth arrest and DNA-damage-inducible, alpha (GADD45A), 20 µg |
CNY 2,900.00 |
|
TP720561 | Recombinant protein of human growth arrest and DNA-damage-inducible, alpha (GADD45A) |
CNY 3,140.00 |
其它GADD45A产品