GADD45A (NM_001924) Human Tagged ORF Clone
CAT#: RC204005
GADD45A (Myc-DDK-tagged)-Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1
ORF Plasmid: tGFP
"NM_001924" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 3,705.00
Cited in 4 publications. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | DDIT1; GADD45 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC204005 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACTTTGGAGGAATTCTCGGCTGGAGAGCAGAAGACCGAAAGGATGGATAAGGTGGGGGATGCCCTGG AGGAAGTGCTCAGCAAAGCCCTGAGTCAGCGCACGATCACTGTCGGGGTGTACGAAGCGGCCAAGCTGCT CAACGTCGACCCCGATAACGTGGTGTTGTGCCTGCTGGCGGCGGACGAGGACGACGACAGAGATGTGGCT CTGCAGATCCACTTCACCCTGATCCAGGCGTTTTGCTGCGAGAACGACATCAACATCCTGCGCGTCAGCA ACCCGGGCCGGCTGGCGGAGCTCCTGCTCTTGGAGACCGACGCTGGCCCCGCGGCGAGCGAGGGCGCCGA GCAGCCCCCGGACCTGCACTGCGTGCTGGTGACGAATCCACATTCATCTCAATGGAAGGATCCTGCCTTA AGTCAACTTATTTGTTTTTGCCGGGAAAGTCGCTACATGGATCAATGGGTTCCAGTGATTAATCTCCCTG AACGG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC204005 protein sequence
Red=Cloning site Green=Tags(s) MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVA LQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPAL SQLICFCRESRYMDQWVPVINLPER myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001924 |
ORF Size | 495 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001924.4 |
RefSeq Size | 1398 bp |
RefSeq ORF | 498 bp |
Locus ID | 1647 |
UniProt ID | P24522 |
Domains | Ribosomal_L7Ae |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | Cell cycle, MAPK signaling pathway, p53 signaling pathway |
MW | 18.3 kDa |
Gene Summary | This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Dec 2010] |
Citations (4)
The use of this cDNA Clones has been cited in the following citations: |
---|
EGR1/GADD45α Activation by ROS of Non-Thermal Plasma Mediates Cell Death in Thyroid Carcinoma
,Jung, SN;Oh, C;Chang, JW;Liu, L;Lim, MA;Jin, YL;Piao, Y;Kim, HJ;Won, HR;Lee, SE;Lee, MJ;Heo, JY;Jun, S;Lee, D;Kang, WS;Kim, DW;Rha, KS;Kim, YI;Kang, YE;Koo, BS;,
Cancers
,PubMed ID 33477921
[GADD45A]
|
GADD45α-targeted suicide gene therapy driven by synthetic CArG promoter E9NS sensitizes NSCLC cells to cisplatin, resveratrol, and radiation regardless of p53 status
,Shi, Q;Sutariya, V;Varghese Gupta, S;Bhatia, D;,
Onco Targets Ther
,PubMed ID 31114253
[GADD45A]
|
An alternative microRNA-mediated post-transcriptional regulation of GADD45A by p53 in human non-small-cell lung cancer cells
,Li, J;Dong, J;Li, S;Xia, W;Su, X;Qin, X;Chen, Y;Ding, H;Li, H;Huang, A;Bai, C;Hu, T;Wang, C;Chu, B;Shao, N;,
Sci Rep
,PubMed ID 28769054
[GADD45A]
|
Gadd45a sensitizes medulloblastoma cells to irradiation and suppresses MMP-9–mediated EMT
,Swapna Asuthkar, Arun Kumar Nalla, Christopher S. Gondi, Dzung H. Dinh, Meena Gujrati, Sanjeeva Mohanam, and Jasti S. Rao,
Neuro Oncology, Oct 2011; 13: 1059 - 1073.
[GADD45A]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC204005L1 | Lenti ORF clone of Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1, Myc-DDK-tagged |
CNY 4,200.00 |
|
RC204005L2 | Lenti ORF clone of Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC204005L3 | Lenti ORF clone of Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1, Myc-DDK-tagged |
CNY 4,200.00 |
|
RC204005L4 | Lenti ORF clone of Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1, mGFP tagged |
CNY 4,200.00 |
|
RG204005 | GADD45A (tGFP-tagged) - Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1 |
CNY 3,400.00 |
|
SC118947 | GADD45A (untagged)-Human growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 1 |
CNY 1,200.00 |
其它GADD45A产品