XTP4 (MIEN1) (NM_032339) Human Mass Spec Standard
CAT#: PH303346
C17orf37 MS Standard C13 and N15-labeled recombinant protein (NP_115715)
View other "XTP4" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | C17orf37 MS Standard C13 and N15-labeled recombinant protein (NP_115715) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203346 |
Predicted MW | 12.4 kDa |
Protein Sequence |
>RC203346 protein sequence
Red=Cloning site Green=Tags(s) MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEIN GQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_115715 |
RefSeq Size | 781 |
RefSeq ORF | 345 |
Synonyms | C17orf37; C35; ORB3; RDX12; XTP4 |
Locus ID | 84299 |
Cytogenetics | 17q12 |
Summary | Increases cell migration by inducing filopodia formation at the leading edge of migrating cells. Plays a role in regulation of apoptosis, possibly through control of CASP3. May be involved in a redox-related process.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410176 | MIEN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410176 | Transient overexpression lysate of chromosome 17 open reading frame 37 (C17orf37) |
CNY 3,080.00 |
|
TP303346 | Recombinant protein of human chromosome 17 open reading frame 37 (C17orf37), 20 µg |
CNY 2,900.00 |