DCPS (NM_014026) Human Mass Spec Standard
CAT#: PH303052
DCPS MS Standard C13 and N15-labeled recombinant protein (NP_054745)
View other "DCPS" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | DCPS MS Standard C13 and N15-labeled recombinant protein (NP_054745) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203052 |
Predicted MW | 38.7 kDa |
Protein Sequence |
>RC203052 protein sequence
Red=Cloning site Green=Tags(s) MADAAPQLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNE ASEDGDGEDAVVILEKTPFQVEQVAQLLTGSPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHL QKYLRQDLRLIRETGDDYRNITLPHLESQSLSIQWVYNILDKKAEADRIVFENPDPSDGFVLIPDLKWNQ QQLDDLYLIAICHRRGIRSLRDLTPEHLPLLRNILHQGQEAILQRYRMKGDHLRVYLHYLPSYYHLHVHF TALGFEAPGSGVERAHLLAEVIENLECDPRHYQQRTLTFALRADDPLLKLLQEAQQS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_054745 |
RefSeq Size | 1508 |
RefSeq ORF | 1011 |
Synonyms | ARS; DCS1; HINT-5; HINT5; HSL1; HSPC015 |
Locus ID | 28960 |
Cytogenetics | 11q24.2 |
Summary | This gene encodes a member of the histidine triad family of pyrophosphatases that removes short mRNA fragments containing the 5′ mRNA cap structure, which appear in the 3′ → 5′ mRNA decay pathway, following deadenylation and exosome-mediated turnover. This enzyme hydrolyzes the triphosphate linkage of the cap structure (7-methylguanosine nucleoside triphosphate) to yield 7-methylguanosine monophosphate and nucleoside diphosphate. It protects the cell from the potentially toxic accumulation of these short, capped mRNA fragments, and regulates the activity of other cap-binding proteins, which are inhibited by their accumulation. It also acts as a transcript-specific modulator of pre-mRNA splicing and microRNA turnover. [provided by RefSeq, Apr 2017] |
Protein Pathways | RNA degradation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415527 | DCPS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415527 | Transient overexpression lysate of decapping enzyme, scavenger (DCPS) |
CNY 3,080.00 |
|
TP303052 | Recombinant protein of human decapping enzyme, scavenger (DCPS), 20 µg |
CNY 2,900.00 |