United States
Germany
Japan
United Kingdom
China
TNFAIP8 (NM_014350) Human Mass Spec Standard
CAT＃: PH302729
TNFAIP8 MS Standard C13 and N15-labeled recombinant protein (NP_055165)
View other "TNFAIP8" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | TNFAIP8 MS Standard C13 and N15-labeled recombinant protein (NP_055165) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202729 |
| Predicted MW | 23 kDa |
| Protein Sequence |
>RC202729 protein sequence
Red=Cloning site Green=Tags(s) MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEK IIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLH QIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055165 |
| RefSeq Size | 2103 |
| RefSeq ORF | 594 |
| Synonyms | GG2-1; MDC-3.13; NDED; SCC-S2; SCCS2 |
| Locus ID | 25816 |
| Cytogenetics | 5q23.1 |
| Summary | Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402318 | TNFAIP8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421470 | TNFAIP8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425876 | TNFAIP8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402318 | Transient overexpression lysate of tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1 |
CNY 3,080.00 |
|
| LY421470 | Transient overexpression lysate of tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2 |
CNY 3,080.00 |
|
| PH320669 | TNFAIP8 MS Standard C13 and N15-labeled recombinant protein (NP_001071122) |
CNY 14,250.00 |
|
| TP302729 | Recombinant protein of human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP320669 | Purified recombinant protein of Homo sapiens tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它TNFAIP8产品
