United States
Germany
Japan
United Kingdom
China
TNFAIP8 (NM_001077654) Human Recombinant Protein
CAT＃: TP320669
Purified recombinant protein of Homo sapiens tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2, 20 µg
View other "TNFAIP8" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC220669 representing NM_001077654
Red=Cloning site Green=Tags(s) MATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVI KLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAK SHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001071122 |
| Locus ID | 25816 |
| UniProt ID | O95379 |
| Refseq Size | 1979 |
| Cytogenetics | 5q23.1 |
| Refseq ORF | 564 |
| Synonyms | GG2-1; MDC-3.13; NDED; SCC-S2; SCCS2 |
| Summary | Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402318 | TNFAIP8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421470 | TNFAIP8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425876 | TNFAIP8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402318 | Transient overexpression lysate of tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1 |
CNY 3,080.00 |
|
| LY421470 | Transient overexpression lysate of tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 2 |
CNY 3,080.00 |
|
| PH302729 | TNFAIP8 MS Standard C13 and N15-labeled recombinant protein (NP_055165) |
CNY 19,520.00 |
|
| PH320669 | TNFAIP8 MS Standard C13 and N15-labeled recombinant protein (NP_001071122) |
CNY 14,250.00 |
|
| TP302729 | Recombinant protein of human tumor necrosis factor, alpha-induced protein 8 (TNFAIP8), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它TNFAIP8产品
