RING1 (NM_002931) Human Mass Spec Standard
CAT#: PH302650
RING1 MS Standard C13 and N15-labeled recombinant protein (NP_002922)
View other "RING1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | RING1 MS Standard C13 and N15-labeled recombinant protein (NP_002922) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202650 |
Predicted MW | 42.4 kDa |
Protein Sequence |
>RC202650 protein sequence
Red=Cloning site Green=Tags(s) MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCS DCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSS IEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAPKRPRGGGAGG SSVGTGGGGTGGVGGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQ TRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPAL PSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002922 |
RefSeq Size | 1744 |
RefSeq ORF | 1218 |
Synonyms | RING1A; RNF1 |
Locus ID | 6015 |
Cytogenetics | 6p21.32 |
Summary | This gene belongs to the RING finger family, members of which encode proteins characterized by a RING domain, a zinc-binding motif related to the zinc finger domain. The gene product can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. The gene product interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in large nuclear domains. It interacts with the CBX4 protein via its glycine-rich C-terminal domain. The gene maps to the HLA class II region, where it is contiguous with the RING finger genes FABGL and HKE4. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401023 | RING1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401023 | Transient overexpression lysate of ring finger protein 1 (RING1) |
CNY 3,080.00 |
|
TP302650 | Recombinant protein of human ring finger protein 1 (RING1), 20 µg |
CNY 2,900.00 |