HSPC142 (BABAM1) (NM_014173) Human Mass Spec Standard
CAT#: PH302644
C19orf62 MS Standard C13 and N15-labeled recombinant protein (NP_054892)
View other "HSPC142" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | C19orf62 MS Standard C13 and N15-labeled recombinant protein (NP_054892) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202644 |
Predicted MW | 36.6 kDa |
Protein Sequence |
>RC202644 protein sequence
Red=Cloning site Green=Tags(s) MEVAEPSSPTEEEEEEEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGP KSWQVPPPAPEVQIRTPRVNCPEKVIICLDLSEEMSLPKLESFNGSKTNALNVSQKMIEMFVRTKHKIDK SHEFALVVVNDDTAWLSGLTSDPRELCSCLYDLETASCSTFNLEGLFSLIQQKTELPVTENVQTIPPPYV VRTILVYSRPPCQPQFSLTEPMKKMFQCPYFFFDVVYIHNGTEEKEEEMSWKDMFAFMGSLDTKGTSYKY EVALAGPALELHNCMAKLLAHPLQRPCQSHASYSLLEEEDEAIEVEATV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_054892 |
RefSeq Size | 1467 |
RefSeq ORF | 987 |
Synonyms | C19orf62; HSPC142; MERIT40; NBA1 |
Locus ID | 29086 |
Cytogenetics | 19p13.11 |
Summary | Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRCA1-A complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX. In the BRCA1-A complex, it is required for the complex integrity and its localization at DSBs. Component of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin in various substrates (PubMed:24075985, PubMed:26195665). In these 2 complexes, it is probably required to maintain the stability of BABAM2 and help the 'Lys-63'-linked deubiquitinase activity mediated by BRCC3/BRCC36 component. The BRISC complex is required for normal mitotic spindle assembly and microtubule attachment to kinetochores via its role in deubiquitinating NUMA1 (PubMed:26195665). Plays a role in interferon signaling via its role in the deubiquitination of the interferon receptor IFNAR1; deubiquitination increases IFNAR1 activity by enhancing its stability and cell surface expression (PubMed:24075985). Down-regulates the response to bacterial lipopolysaccharide (LPS) via its role in IFNAR1 deubiquitination (PubMed:24075985).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415463 | BABAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422382 | BABAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415463 | Transient overexpression lysate of chromosome 19 open reading frame 62 (C19orf62), transcript variant 2 |
CNY 3080.00 |
|
LY422382 | Transient overexpression lysate of chromosome 19 open reading frame 62 (C19orf62), transcript variant 1 |
CNY 3080.00 |
|
PH310626 | C19orf62 MS Standard C13 and N15-labeled recombinant protein (NP_001028721) |
CNY 19520.00 |
|
TP302644 | Recombinant protein of human chromosome 19 open reading frame 62 (C19orf62), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP310626 | Recombinant protein of human chromosome 19 open reading frame 62 (C19orf62), transcript variant 1, 20 µg |
CNY 2900.00 |
其它HSPC142产品