PKM2 (PKM) (NM_002654) Human Mass Spec Standard
CAT#: PH301855
PKM2 MS Standard C13 and N15-labeled recombinant protein (NP_002645)
View other "PKM2" proteins (12)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Cited in 1 publication. |
Specifications
Product Data | |
Description | PKM2 MS Standard C13 and N15-labeled recombinant protein (NP_002645) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201855 |
Predicted MW | 57.9 kDa |
Protein Sequence |
>RC201855 protein sequence
Red=Cloning site Green=Tags(s) MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMN VARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATL KITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVN LPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRF DEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVAN AVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEAS FKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRV NFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002645 |
RefSeq Size | 2516 |
RefSeq ORF | 1593 |
Synonyms | CTHBP; HEL-S-30; OIP3; p58; PK3; PKM2; TCB; THBP1 |
Locus ID | 5315 |
Cytogenetics | 15q23 |
Summary | This gene encodes a protein involved in glycolysis. The encoded protein is a pyruvate kinase that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate to ADP, generating ATP and pyruvate. This protein has been shown to interact with thyroid hormone and may mediate cellular metabolic effects induced by thyroid hormones. This protein has been found to bind Opa protein, a bacterial outer membrane protein involved in gonococcal adherence to and invasion of human cells, suggesting a role of this protein in bacterial pathogenesis. Several alternatively spliced transcript variants encoding a few distinct isoforms have been reported. [provided by RefSeq, May 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Glycolysis / Gluconeogenesis, Metabolic pathways, Purine metabolism, Pyruvate metabolism, Type II diabetes mellitus |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Reciprocal Regulation of Protein Kinase and Pyruvate Kinase Activities of Pyruvate Kinase M2 by Growth Signals *
,null,
The Journal of Biological Chemistry
,PubMed ID 23576436
[PKM]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405537 | PKM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC405538 | PKM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC419188 | PKM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405537 | Transient overexpression lysate of pyruvate kinase, muscle (PKM2), transcript variant 2 |
CNY 4,840.00 |
|
LY405538 | Transient overexpression lysate of pyruvate kinase, muscle (PKM2), transcript variant 3 |
CNY 4,840.00 |
|
LY419188 | Transient overexpression lysate of pyruvate kinase, muscle (PKM2), transcript variant 1 |
CNY 3,080.00 |
|
PH319382 | PKM2 MS Standard C13 and N15-labeled recombinant protein (NP_872270) |
CNY 19,520.00 |
|
PH322698 | PKM2 MS Standard C13 and N15-labeled recombinant protein (NP_872271) |
CNY 19,520.00 |
|
TP301855 | Recombinant protein of human pyruvate kinase, muscle (PKM2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP319382 | Recombinant protein of human pyruvate kinase, muscle (PKM2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP322698 | Recombinant protein of human pyruvate kinase, muscle (PKM2), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP721212 | Purified recombinant protein of Human pyruvate kinase, muscle (PKM2), transcript variant 1 |
CNY 3,140.00 |