NM23A (NME1) (NM_000269) Human Mass Spec Standard
CAT#: PH301731
NME1 MS Standard C13 and N15-labeled recombinant protein (NP_000260)
View other "NM23A" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | NME1 MS Standard C13 and N15-labeled recombinant protein (NP_000260) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201731 |
Predicted MW | 17.1 kDa |
Protein Sequence |
>RC201731 protein sequence
Red=Cloning site Green=Tags(s) MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHS GPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELV DYTSCAQNWIYE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000260 |
RefSeq Size | 811 |
RefSeq ORF | 456 |
Synonyms | AWD; GAAD; NB; NBS; NDKA; NDPK-A; NDPKA; NM23; NM23-H1 |
Locus ID | 4830 |
Cytogenetics | 17q21.33 |
Summary | This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | Metabolic pathways, Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400102 | NME1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404982 | NME1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400102 | Transient overexpression lysate of non-metastatic cells 1, protein (NM23A) expressed in (NME1), transcript variant 2 |
CNY 3,080.00 |
|
LY404982 | Transient overexpression lysate of non-metastatic cells 1, protein (NM23A) expressed in (NME1), transcript variant 1 |
CNY 3,080.00 |
|
PH320517 | NME1 MS Standard C13 and N15-labeled recombinant protein (NP_937818) |
CNY 19,520.00 |
|
TP301731 | Recombinant protein of human non-metastatic cells 1, protein (NM23A) expressed in (NME1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP320517 | Recombinant protein of human non-metastatic cells 1, protein (NM23A) expressed in (NME1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP720214 | Recombinant protein of human non-metastatic cells 1, protein (NM23A) expressed in (NME1), transcript variant 2 |
CNY 1,800.00 |