RGS19 (NM_001039467) Human Mass Spec Standard
CAT#: PH301715
RGS19 MS Standard C13 and N15-labeled recombinant protein (NP_001034556)
View other "RGS19" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RGS19 MS Standard C13 and N15-labeled recombinant protein (NP_001034556) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201715 |
Predicted MW | 24.6 kDa |
Protein Sequence |
>RC201715 protein sequence
Red=Cloning site Green=Tags(s) MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPL PSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKAR LIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGP SQSSSEA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001034556 |
RefSeq Size | 1493 |
RefSeq ORF | 651 |
Synonyms | GAIP; RGSGAIP |
Locus ID | 10287 |
Cytogenetics | 20q13.33 |
Summary | G proteins mediate a number of cellular processes. The protein encoded by this gene belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling. Alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417015 | RGS19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422051 | RGS19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417015 | Transient overexpression lysate of regulator of G-protein signaling 19 (RGS19), transcript variant 1 |
CNY 3,080.00 |
|
LY422051 | Transient overexpression lysate of regulator of G-protein signaling 19 (RGS19), transcript variant 2 |
CNY 3,080.00 |
|
PH309082 | RGS19 MS Standard C13 and N15-labeled recombinant protein (NP_005864) |
CNY 19,520.00 |
|
TP301715 | Recombinant protein of human regulator of G-protein signaling 19 (RGS19), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP309082 | Recombinant protein of human regulator of G-protein signaling 19 (RGS19), transcript variant 1, 20 µg |
CNY 2,900.00 |