RGS19 Rabbit Polyclonal Antibody
CAT#: TA334728
Rabbit Polyclonal Anti-RGS19 Antibody
Need it in bulk or conjugated?
Get a free quote
CN¥ 4,628.00
CN¥ 3,080.00
CN¥ 2,900.00
CN¥ 6,650.00
CN¥ 9,998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RGS19 antibody is: synthetic peptide directed towards the N-terminal region of Human RGS19. Synthetic peptide located within the following region: PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSW |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 25 kDa |
Gene Name | regulator of G-protein signaling 19 |
Database Link | |
Background | G proteins mediate a number of cellular processes. RGS19 belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling. |
Synonyms | GAIP; RGSGAIP |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Pig: 92%; Bovine: 92%; Guinea pig: 92%; Dog: 85% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |