CIRBP (NM_001280) Human Mass Spec Standard
CAT#: PH301639
CIRBP MS Standard C13 and N15-labeled recombinant protein (NP_001271)
View other "CIRBP" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | CIRBP MS Standard C13 and N15-labeled recombinant protein (NP_001271) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201639 |
Predicted MW | 18.6 kDa |
Protein Sequence |
>RC201639 protein sequence
Red=Cloning site Green=Tags(s) MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGK SVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRD YYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001271 |
RefSeq Size | 1397 |
RefSeq ORF | 516 |
Synonyms | CIRP |
Locus ID | 1153 |
Cytogenetics | 19p13.3 |
Summary | Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3' UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor (By similarity). Promotes assembly of stress granules (SGs), when overexpressed.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420029 | CIRBP HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY420029 | Transient overexpression lysate of cold inducible RNA binding protein (CIRBP), transcript variant 1 |
CN¥ 3,080.00 |
|
TP301639 | Recombinant protein of human cold inducible RNA binding protein (CIRBP), transcript variant 1, 20 µg |
CN¥ 2,900.00 |