GATA3 (NM_002051) Human Mass Spec Standard
CAT#: PH301618
GATA3 MS Standard C13 and N15-labeled recombinant protein (NP_002042)
View other "GATA3" proteins (8)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | GATA3 MS Standard C13 and N15-labeled recombinant protein (NP_002042) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201618 |
Predicted MW | 48 kDa |
Protein Sequence |
>RC201618 protein sequence
Red=Cloning site Green=Tags(s) MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRA TVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSS LSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGG ASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGT GHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHN INRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTP TPMHPPSSLSFGPHHPSSMVTAMG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002042 |
RefSeq Size | 3067 |
RefSeq ORF | 1332 |
Synonyms | HDR; HDRS |
Locus ID | 2625 |
Cytogenetics | 10p14 |
Summary | This gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains two GATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelial cell biology. Defects in this gene are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia. [provided by RefSeq, Nov 2009] |
Protein Families | Adult stem cells, ES Cell Differentiation/IPS, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400759 | GATA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC424146 | GATA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LY400759 | Transient overexpression lysate of GATA binding protein 3 (GATA3), transcript variant 2 |
CN¥ 3,080.00 |
|
LY424146 | Transient overexpression lysate of GATA binding protein 3 (GATA3), transcript variant 1 |
CN¥ 4,840.00 |
|
TP301618 | Recombinant protein of human GATA binding protein 3 (GATA3), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP761574 | Purified recombinant protein of Human GATA binding protein 3 (GATA3), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CN¥ 2,040.00 |
|
TP762348 | Purified recombinant protein of Human GATA binding protein 3 (GATA3), transcript variant 1, Pro189-Ser201(8 reapeat regions linked with GGGGS), with N-terminal His tag, expressed in E.coli, 50ug |
CN¥ 1,950.00 |
|
TP762449 | Purified recombinant protein of Human GATA binding protein 3 (GATA3), transcript variant 1, Met1-Thr156, with N-terminal His tag, expressed in E.coli, 50ug |
CN¥ 1,950.00 |