United States
Germany
Japan
United Kingdom
China
PLAUR (NM_002659) Human Mass Spec Standard
CAT＃: PH301222
PLAUR MS Standard C13 and N15-labeled recombinant protein (NP_002650)
View other "PLAUR" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | PLAUR MS Standard C13 and N15-labeled recombinant protein (NP_002650) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201222 |
| Predicted MW | 37 kDa |
| Protein Sequence |
>RC201222 protein sequence
Red=Cloning site Green=Tags(s) MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHS EKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSP EEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLP QNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSM NHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002650 |
| RefSeq Size | 1570 |
| RefSeq ORF | 1005 |
| Synonyms | CD87; U-PAR; UPAR; URKR |
| Locus ID | 5329 |
| Cytogenetics | 19q13.31 |
| Summary | This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized degradation of the extracellular matrix. It binds both the proprotein and mature forms of urokinase plasminogen activator and permits the activation of the receptor-bound pro-enzyme by plasmin. The protein lacks transmembrane or cytoplasmic domains and may be anchored to the plasma membrane by a glycosyl-phosphatidylinositol (GPI) moiety following cleavage of the nascent polypeptide near its carboxy-terminus. However, a soluble protein is also produced in some cell types. Alternative splicing results in multiple transcript variants encoding different isoforms. The proprotein experiences several post-translational cleavage reactions that have not yet been fully defined. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Complement and coagulation cascades |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400943 | PLAUR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423709 | PLAUR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423710 | PLAUR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400943 | Transient overexpression lysate of plasminogen activator, urokinase receptor (PLAUR), transcript variant 1 |
CNY 3,080.00 |
|
| LY423709 | Transient overexpression lysate of plasminogen activator, urokinase receptor (PLAUR), transcript variant 2 |
CNY 3,080.00 |
|
| LY423710 | Transient overexpression lysate of plasminogen activator, urokinase receptor (PLAUR), transcript variant 3 |
CNY 3,080.00 |
|
| PH317929 | PLAUR MS Standard C13 and N15-labeled recombinant protein (NP_001005376) |
CNY 14,250.00 |
|
| TP301222 | Recombinant protein of human plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP317929 | Purified recombinant protein of Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP720329 | Recombinant protein of human plasminogen activator, urokinase receptor (PLAUR), transcript variant 2 |
CNY 3,140.00 |
