Neurogranin (NRGN) (NM_006176) Human Mass Spec Standard
CAT#: PH301209
NRGN MS Standard C13 and N15-labeled recombinant protein (NP_006167)
View other "Neurogranin" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | NRGN MS Standard C13 and N15-labeled recombinant protein (NP_006167) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201209 |
Predicted MW | 7.6 kDa |
Protein Sequence |
>RC201209 protein sequence
Red=Cloning site Green=Tags(s) MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGG AGGGPSGD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006167 |
RefSeq Size | 1235 |
RefSeq ORF | 234 |
Synonyms | hng; RC3 |
Locus ID | 4900 |
Cytogenetics | 11q24.2 |
Summary | Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416815 | NRGN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426667 | NRGN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416815 | Transient overexpression lysate of neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 1 |
CNY 3,080.00 |
|
LY426667 | Transient overexpression lysate of neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 2 |
CNY 3,080.00 |
|
PH324996 | NRGN MS Standard C13 and N15-labeled recombinant protein (NP_001119653) |
CNY 19,520.00 |
|
TP301209 | Recombinant protein of human neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP324996 | Recombinant protein of human neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Neurogranin产品